Chicken Whole Blood
Kingfisher Biotech Inc Bovine IL-1 Receptor Antagonist Biotinylated Recombinant Protein
The Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated applications are for cell culture. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: HPLGKRRCEM QAFRIWDVNQ KIFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHTMFLGI HGGKLCLACV KSGDEIKLKL EAVNITDLNQ NREQDKRFAF IRFDNGPTTS FESAACPGWF LCTSLEADQP VGLTNMPTEA LKVTKFYFQQ D (151)) (Gene ID: 281860). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Biotinylated Recombinant Protein
The Chicken IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma Biotinylated applications are for cell culture. Chicken IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Biotinylated Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQLQDDIDKLKADFNSSHSDVADGGPIIVEKLKNWTERNEKRIILSQIVSMYLEMLENTDKSKPHTKHISEELYTLKNNLPDGVKKVKDIMDLAKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Swine TNF alpha Biotinylated Recombinant Protein
The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret/Mink LIF Recombinant Protein
The Ferret/Mink Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret/Mink Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Ferret/Mink Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Ferret/Mink Leukemia Inhibitory Factor Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: TPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD ILRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF (180)) (Gene ID: 101674557). For research use only. Made in the USA
Kingfisher Biotech Inc Mallard IL-4 Recombinant Protein
The Duck IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Duck IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. Duck IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Duck IL-4 Specifications: (Molecular Weight: 12.8 kDa) (Amino Acid Sequence: HEAAVLERSI FLKESIRLLG EILSTQVSCD KANVTNVFAG NETGTDMELL CKASTVVFES LSCHKPLKGI YLNLLHIVTK STSLKAPCPV AAGNTTSLQE FLRGLHRTLQ RVAKENL (117)) (Gene ID: 101801081). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey CXCL7 Recombinant Protein
The Cynomolgus Monkey CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL7 Specifications: (Molecular Weight: 10.3 kDa) (Amino Acid Sequence: SSTKGQTKRN LAKGKEESLD SELYTELRCL CMKTTSGIHP KNIQSLEVIG KGIHCNQVEV IATLKDGRKI CLDPDAPRIK KIVQKKLAGD ESAD (94)) (Gene ID: 102124735). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CXCL7 Recombinant Protein
The Swine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL7 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: AAKIEGRMAH VELRCLCLNT VSGIHPSNIQ SLEVIRAGAH CAKVEVIATL KNDKKICLDP EAPRIKKIVQ KIMEDGGSAA (80)) (Gene ID: 396870). For research use only. Made in the USA
Kingfisher Biotech Inc Canine CXCL7 Recombinant Protein
The Canine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Canine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Canine CXCL7 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: ETKSVDCERF LELRCMCTKT VSGIHPSNIQ NLEVLRAGPH CANVEVIAML KNGKRICLDP EAPKIKRIVQ KILESAERTA (80)) (Gene ID: 482196). For research use only. Made in the USA
Kingfisher Biotech Inc Bat CXCL10 Recombinant Protein
The Black/Large flying fox Bat CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Black/Large flying fox Bat CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Black/Large flying fox Bat CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Black/Large flying fox Bat CXCL10 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: IPLFRTSRCV CIKISDQPVN LKSLEKLEVI PASQSCPQVE IIATMKKNGE KRCLNTKSKA VKNILKSISK ER (72)) (Gene ID: 102880650). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret CXCL13 Recombinant Protein
The Ferret CXCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret CXCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret CXCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret CXCL13 Specifications: (Molecular Weight: 9.9 kDa) (Amino Acid Sequence: VLEAYNTNLK CKCIQETSAF VPVNHIDKLQ VFPPGNGCPN KEVIVWKKNK SVVCLNPHSK WTQKLIKILQ RNAASTRPAP VLRRRMK (87)) (Gene ID: 101672630). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret IL-6 Recombinant Protein
The Ferret IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IL-6 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: FPTPGPLGGD SKDDATSNRP PLTSADKMED FIRFILGKIS ALKKEMCEKY NKCEDSKEAL AENNLNLPKL AEEDKCFQSQ FNQETCLTRI TTGLQEFQIH LKYLEANYEG NKNNAHSVYI STKHLLQKLR PMNRVEVTTP DPTTDSSLQA LFKSQDKWLK HVTIHLILRS LEDFLQFSLR AIRIM (185)) (Gene ID: 101671465). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-16 Recombinant Protein
The Swine IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. Swine IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-16 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: ASPDLNSSTD SAASVSVASD ISIDSTEATV CTVTLEKTSA GLGFSLEGGK GSLHGDKPLT INRIFRGAAS EQNETIQPGD EILHLAGTAV QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKGTTGAGDP (130)) (Gene ID: 396589). For research use only. Made in the USA
Kingfisher Biotech Inc Canine IL-25 Recombinant Protein
The Canine IL-25 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-25 applications are for cell culture, ELISA standard, and Western Blot Control. Canine IL-25 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-25 Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: LNFRIRKDCT HWPNCCPSKR QDPTHEWLKR DTVLKFPGET TSLTHHPESC KASEDGPLNS RSISPWKYEL DRDLNRLPQD LYHARCLCQH CVSLQTGSHM DPLGNSELLY HNQTVFYRRP CPGEQGAPDG YCLEQRLYRV SLACVCVRPR VMA). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine CXCL1 Recombinant Protein
The Bovine CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL1 Specifications: (Molecular Weight: 8.0 kDa) (Amino Acid Sequence: GAPVVNELRC QCLQTLQGIH LKNIQSVKVT TPGPHCDQTE VIASLKTGQE VCLNPTAPMV KKIIDKMLNK ASAN (74)) (Gene ID: 281212). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine CXCL4 Recombinant Protein
The Bovine CXCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL4 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CXCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL4 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: QESSFPATFV PLPADSEGGE SEDLQCVCLK TTSGINPRHI SSLEVIGAGL HCPSPQLIAT LKTGRKICLD QQNPLYKKII KRLLKS (86)) (Gene ID: 507790). For research use only. Made in the USA